PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_27637_iso_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB
Protein Properties Length: 230aa    MW: 26839.6 Da    PI: 8.7797
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_27637_iso_1genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.11.5e-161057148
                                         TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                      Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                                         +g+WT+eEd +l+  ++++G  +W++ ++  g+ R++k+c++rw +yl
  cra_locus_27637_iso_1_len_721_ver_3 10 KGAWTAEEDHILISFIQKYGHQNWRALPKQAGLLRCGKSCRLRWTNYL 57
                                         79******************************99************97 PP

2Myb_DNA-binding55.41.4e-1763108148
                                          TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
                      Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                          rg++T+eE+e ++++++  G++ W++Ia +++ gRt++++k++w+++l
  cra_locus_27637_iso_1_len_721_ver_3  63 RGNFTKEEEETIINLHQFIGNR-WSAIATRLP-GRTDNEIKNYWHTHL 108
                                          89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.868557IPR017930Myb domain
SuperFamilySSF466891.5E-306104IPR009057Homeodomain-like
SMARTSM007172.3E-12959IPR001005SANT/Myb domain
PfamPF002492.0E-151057IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.5E-241164IPR009057Homeodomain-like
CDDcd001675.58E-91257No hitNo description
PROSITE profilePS5129425.09258112IPR017930Myb domain
SMARTSM007172.3E-1662110IPR001005SANT/Myb domain
PfamPF002496.8E-1663108IPR001005SANT/Myb domain
CDDcd001677.26E-1165108No hitNo description
Gene3DG3DSA:1.10.10.605.5E-2765112IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 230 aa     Download sequence    Send to blast
XCCERMGMKK GAWTAEEDHI LISFIQKYGH QNWRALPKQA GLLRCGKSCR LRWTNYLRPD  60
IKRGNFTKEE EETIINLHQF IGNRWSAIAT RLPGRTDNEI KNYWHTHLKK RVQENSAMAS  120
SKRQRFGSNN IRISETWNFS NQYLNNFKNI NGYCYNANNF HTNWSGELAG EIDHDDRKSS  180
SDGQDQICLM NKVLMESRSR AEVLSTTTGE YDFSNNDADF WYNVFVNAGN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-2881125108B-MYB
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009606766.15e-76PREDICTED: myb-related protein Myb4-like
TrEMBLM1C5C09e-76M1C5C0_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000601683e-75(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA12242154